Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00018.161
Common NameAMTR_s00018p00250840, LOC18436499
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 561aa    MW: 60823.8 Da    PI: 8.214
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00018.161genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                               d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  evm_27.model.AmTr_v1.0_scaffold00018.161 166 DPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVE 209
                                               79***************************************987 PP

                                       QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                               +FT++Q+q+L++Q+l++Ky++a++PvP++L+ +i+k
  evm_27.model.AmTr_v1.0_scaffold00018.161 108 PFTPSQWQELEQQALIFKYMMASVPVPQDLVNPIRK 143
                                               8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-11107143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.161108143IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.8E-16108142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.609166210IPR014977WRC domain
PfamPF088794.0E-21167209IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846580.10.0PREDICTED: growth-regulating factor 4
TrEMBLW1PM890.0W1PM89_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-42growth-regulating factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089